Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC28
Confidence8.71%DateThu Jan 5 11:17:01 GMT 2012
Rank46Aligned Residues27
% Identity22%Templated1w7ab4
SCOP infoMutS N-terminal domain-like DNA repair protein MutS, domain I DNA repair protein MutS, domain I
Resolution2.27

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   135....140.........150.........160.........170......
Predicted Secondary structure 




















Query SS confidence 









































Query Sequence  DRTLQNWQHYKTQPVGYAHDCQLVEKLPVEEWDIPLPAVVTP
Query Conservation 

 
          

 
   
    

 
 

  

 



Alig confidence 








.







..............









Template Conservation     
  

 . 
 

 
 ..............

 

 



Template Sequence  ENYLAKLVN. QGESVAIC. . . . . . . . . . . . . . ERKVVRIVTP
Template Known Secondary structure  .TT

..............




Template Predicted Secondary structure  .


..............


Template SS confidence 









































   77..80..... ....90... ......100...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions