Return to main results Retrieve Phyre Job Id

Job DescriptionP77165
Confidence37.34%DateThu Jan 5 12:25:51 GMT 2012
Rank97Aligned Residues38
% Identity18%Templatec3itcA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:renal dipeptidase; PDBTitle: crystal structure of sco3058 with bound citrate and glycerol
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   169170.........180.........190.........200.........210.........220.........
Predicted Secondary structure 































Query SS confidence 




























































Query Sequence  SVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIEDAAGEIKS
Query Conservation 
 


                 

 

  


 











  

 

  

     
Alig confidence 






.................














......















Template Conservation     
  
.................


   
 

 


 ......


   

  
  
  
Template Sequence  IAELLDR. . . . . . . . . . . . . . . . . GWSQSDLAKLTWKNA. . . . . . VRVLDAAEDVSRGLRA
Template Known Secondary structure  T.................T

T......
Template Predicted Secondary structure 
.................


......
Template SS confidence 




























































   341...... ..350.........360.. .......370........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions