Return to main results Retrieve Phyre Job Id

Job DescriptionP15723
Confidence97.10%DateThu Jan 5 11:34:52 GMT 2012
Rank15Aligned Residues42
% Identity19%Templated3b57a1
SCOP infoHD-domain/PDEase-like HD-domain/PDEase-like HD domain
Resolution3.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   61........70.........80.........90.........100.........110.........120..
Predicted Secondary structure 
























Query SS confidence 





























































Query Sequence  AAVRTRLTHSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTGPFESIVEMSCLMHDIGNP
Query Conservation 
 


















  
   
                    




 







Alig confidence 




.




















...................















Template Conservation     
 .  
  

   
  

   
 
...................   
 








  
Template Sequence  SHFHD. WSHIKRVWKLSKEIQSKEGGD. . . . . . . . . . . . . . . . . . . LFTIELAALFHDYSDQ
Template Known Secondary structure  TT


.
S
...................TT



Template Predicted Secondary structure 



.


...................


Template SS confidence 





























































   16...20 .........30.........40. ........50.......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions