Return to main results Retrieve Phyre Job Id

Job DescriptionP15723
Confidence93.31%DateThu Jan 5 11:34:52 GMT 2012
Rank42Aligned Residues36
% Identity14%Templated1ynba1
SCOP infoHD-domain/PDEase-like HD-domain/PDEase-like HD domain
Resolution1.76

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6970.........80.........90.........100.........110.........120
Predicted Secondary structure 















Query SS confidence 



















































Query Sequence  HSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTGPFESIVEMSCLMHDIG
Query Conservation 












  
   
                    




 





Alig confidence 


















................
















Template Conservation 

 


 

  

      ................  
  
    

 


 
Template Sequence  HNFRAAIIAFILALKSGES. . . . . . . . . . . . . . . . VEKACKAATAALFHDLH
Template Known Secondary structure  TT

................TTTT
Template Predicted Secondary structure 



................


Template SS confidence 



















































   42.......50.........60 .........70.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions