Return to main results Retrieve Phyre Job Id

Job DescriptionP15723
Confidence90.81%DateThu Jan 5 11:34:52 GMT 2012
Rank48Aligned Residues35
% Identity11%Templated1vqra_
SCOP infoHD-domain/PDEase-like HD-domain/PDEase-like modified HD domain
Resolution2.25

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   68.70.........80.........90.........100.........110.........120
Predicted Secondary structure 















Query SS confidence 




















































Query Sequence  THSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTGPFESIVEMSCLMHDIG
Query Conservation 













  
   
                    




 





Alig confidence 



















..................














Template Conservation    
   
  
  

      ..................  
 
  







Template Sequence  KTCNEEATFIANWLNDEDKK. . . . . . . . . . . . . . . . . . LSHLLVPCAXLLRLG
Template Known Secondary structure  TTT
..................
Template Predicted Secondary structure 


..................
Template SS confidence 




















































   115....120.........130.... .....140.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions