Return to main results Retrieve Phyre Job Id

Job DescriptionP15723
Confidence21.76%DateThu Jan 5 11:34:52 GMT 2012
Rank78Aligned Residues20
% Identity35%Templatec3oa8B_
PDB info PDB header:heme-binding protein/heme-binding proteiChain: B: PDB Molecule:soxx; PDBTitle: diheme soxax
Resolution1.77 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   122.......130.........140.........150.........160.........170.........180...
Predicted Secondary structure 










































Query SS confidence 





























































Query Sequence  PPFGHFGEAAINDWFRQRLHPEDAESQPLTDDRCSVAALRLRDGEEPLNELRRKIRQDLCHF
Query Conservation 




 

 

                                       
      
   
Alig confidence 







..........................................











Template Conservation 
 

    ..........................................

 


 




Template Sequence  PRFGVNGV. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . LTEQQIKDVVAY
Template Known Secondary structure 

TTTTTS..........................................S
Template Predicted Secondary structure 







..........................................

Template SS confidence 





























































   179180...... ...190........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions