Return to main results Retrieve Phyre Job Id

Job DescriptionP15723
Confidence28.70%DateThu Jan 5 11:34:52 GMT 2012
Rank72Aligned Residues31
% Identity29%Templatec3nqwB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:cg11900; PDBTitle: a metazoan ortholog of spot hydrolyzes ppgpp and plays a role in2 starvation responses
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   67..70.........80.........90.........100.........110.........
Predicted Secondary structure 















Query SS confidence 




















































Query Sequence  LTHSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTGPFESIVEMSCLMHDI
Query Conservation 














  
   
                    




 




Alig confidence 

















......................












Template Conservation    
   

 

       ......................
 
 
 






Template Sequence  VNHVINVSTILSVEACIT. . . . . . . . . . . . . . . . . . . . . . DEGVLMAALLHDV
Template Known Secondary structure  TS


......................
TTT
Template Predicted Secondary structure 



......................
Template SS confidence 




















































   34.....40.........50. ........60....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions