Return to main results Retrieve Phyre Job Id

Job DescriptionP15723
Confidence81.68%DateThu Jan 5 11:34:52 GMT 2012
Rank53Aligned Residues34
% Identity18%Templatec3ljvA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:mmoq response regulator; PDBTitle: crystal structure of mmoq response regulator (fragment 29-302) from2 methylococcus capsulatus str. bath, northeast structural genomics3 consortium target mcr175m
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   67..70.........80.........90.........100.........110.........120
Predicted Secondary structure 
















Query SS confidence 





















































Query Sequence  LTHSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTGPFESIVEMSCLMHDIG
Query Conservation 














  
   
                    




 





Alig confidence 



















....................













Template Conservation     
   
  
  

     .................... 
 
   






Template Sequence  WQKSLARAVALQSITAQAVA. . . . . . . . . . . . . . . . . . . . PKEAFTLGLLADVG
Template Known Secondary structure  TTGGG


....................TT
Template Predicted Secondary structure 


....................


Template SS confidence 





















































   128.130.........140....... ..150.........160.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions