Return to main results Retrieve Phyre Job Id

Job DescriptionP15723
Confidence79.55%DateThu Jan 5 11:34:52 GMT 2012
Rank54Aligned Residues36
% Identity25%Templatec3kh1B_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:predicted metal-dependent phosphohydrolase; PDBTitle: crystal structure of predicted metal-dependent2 phosphohydrolase (zp_00055740.2) from magnetospirillum3 magnetotacticum ms-1 at 1.37 a resolution
Resolution1.37 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   68.70.........80.........90.........100.........110.........120
Predicted Secondary structure 















Query SS confidence 




















































Query Sequence  THSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTGPFESIVEMSCLMHDIG
Query Conservation 













  
   
                    




 





Alig confidence 



















.................















Template Conservation 


   

 
  

      .................

  

  






 
Template Sequence  EHSWHIATXAFLLAEYADEA. . . . . . . . . . . . . . . . . VQIGRVARXLLIHDIV
Template Known Secondary structure  TGGGS
TT.................

TTTT
Template Predicted Secondary structure 



.................

Template SS confidence 




















































   42.......50.........60. ........70.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions