Return to main results Retrieve Phyre Job Id

Job DescriptionP15723
Confidence79.14%DateThu Jan 5 11:34:52 GMT 2012
Rank55Aligned Residues40
% Identity18%Templatec3hi0B_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:putative exopolyphosphatase; PDBTitle: crystal structure of putative exopolyphosphatase (17739545) from2 agrobacterium tumefaciens str. c58 (dupont) at 2.30 a resolution
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   68.70.........80.........90.........100.........110.........120.
Predicted Secondary structure 
















Query SS confidence 





















































Query Sequence  THSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTGPFESIVEMSCLMHDIGN
Query Conservation 













  
   
                    




 






Alig confidence 


















..............




















Template Conservation   

  
   
  

  
  ..............      
 

  

 




 
Template Sequence  EHARELADWSGRTFPVFGI. . . . . . . . . . . . . . DETEEESRYRQAACLLADISW
Template Known Secondary structure  GGGGT
..............


TTTTTT
Template Predicted Secondary structure 


..............




Template SS confidence 





















































   333......340.........350. ........360.........370..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions