Return to main results Retrieve Phyre Job Id

Job DescriptionP15723
Confidence94.38%DateThu Jan 5 11:34:52 GMT 2012
Rank35Aligned Residues35
% Identity29%Templatec3hc1A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized hdod domain protein; PDBTitle: crystal structure of hdod domain protein with unknown function2 (np_953345.1) from geobacter sulfurreducens at 1.90 a resolution
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   68.70.........80.........90.........100.........110.........120
Predicted Secondary structure 















Query SS confidence 




















































Query Sequence  THSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTGPFESIVEMSCLMHDIG
Query Conservation 













  
   
                    




 





Alig confidence 


















..................















Template Conservation   

   
  
  

     ..................     
  







Template Sequence  AHSLGVARIAKLIAERTGF. . . . . . . . . . . . . . . . . . LNPVNVYVAGLLHDVG
Template Known Secondary structure  TT
..................S
TTT
Template Predicted Secondary structure 


..................




Template SS confidence 




















































   120.........130........ .140.........150....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions