Return to main results Retrieve Phyre Job Id

Job DescriptionP15723
Confidence94.91%DateThu Jan 5 11:34:52 GMT 2012
Rank26Aligned Residues43
% Identity21%Templatec2o8hA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:phosphodiesterase-10a; PDBTitle: crystal structure of the catalytic domain of rat2 phosphodiesterase 10a
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   68.70.........80.........90.........100.........110.........120....
Predicted Secondary structure 



















Query SS confidence 
























































Query Sequence  THSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTGPFESIVEMSCLMHDIGNPPF
Query Conservation 













  
   
                    




 









Alig confidence 


























..............















Template Conservation   

 

 
     
      
   
  ..............






 


 


 
Template Sequence  KHAVTVAHCMYAILQNNNGLFTDLERK. . . . . . . . . . . . . . GLLIACLCHDLDHRGF
Template Known Secondary structure  TSTTTS
..............TTTT

S
Template Predicted Secondary structure 




..............






Template SS confidence 
























































   518.520.........530.........540.... .....550.........560
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions