Return to main results Retrieve Phyre Job Id

Job DescriptionP15723
Confidence97.66%DateThu Jan 5 11:34:52 GMT 2012
Rank12Aligned Residues36
% Identity25%Templatec2o08B_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:bh1327 protein; PDBTitle: crystal structure of a putative hd superfamily hydrolase (bh1327) from2 bacillus halodurans at 1.90 a resolution
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   66...70.........80.........90.........100.........110.........120
Predicted Secondary structure 

















Query SS confidence 






















































Query Sequence  RLTHSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTGPFESIVEMSCLMHDIG
Query Conservation 















  
   
                    




 





Alig confidence 





















...................













Template Conservation     

  

  
  

   
 
...................      







Template Sequence  RYQHTIGVXETAIDLAKLYGAD. . . . . . . . . . . . . . . . . . . QQKAELAAIFHDYA
Template Known Secondary structure  T

...................TTTT
Template Predicted Secondary structure 



...................
Template SS confidence 






















































   18.20.........30......... 40.........50...
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions