Return to main results Retrieve Phyre Job Id

Job DescriptionP15723
Confidence14.66%DateThu Jan 5 11:34:52 GMT 2012
Rank92Aligned Residues24
% Identity33%Templatec2huoA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:inositol oxygenase; PDBTitle: crystal structure of mouse myo-inositol oxygenase in complex with2 substrate
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   81........90.........100.........110.........120
Predicted Secondary structure 















Query SS confidence 







































Query Sequence  AKEILSRLKELKLLEAYGLDELTGPFESIVEMSCLMHDIG
Query Conservation 
  
   
                    




 





Alig confidence 






................
















Template Conservation 

 

  ................ 
  

 

 






Template Sequence  AEGIRKA. . . . . . . . . . . . . . . . HPDKDWFHLVGLLHDLG
Template Known Secondary structure  ................
TT
TTGG
Template Predicted Secondary structure  ................



Template SS confidence 







































   103...... 110.........120......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions