Return to main results Retrieve Phyre Job Id

Job DescriptionP15723
Confidence93.64%DateThu Jan 5 11:34:52 GMT 2012
Rank40Aligned Residues39
% Identity21%Templatec2cqzA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:177aa long hypothetical protein; PDBTitle: crystal structure of ph0347 protein from pyrococcus horikoshii ot3
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   68.70.........80.........90.........100.........110.........120
Predicted Secondary structure 















Query SS confidence 




















































Query Sequence  THSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTGPFESIVEMSCLMHDIG
Query Conservation 













  
   
                    




 





Alig confidence 


















..............



















Template Conservation 


 


 

  

     ..............    

  
    

 


 
Template Sequence  DHSFGVAFITLVLADVLEK. . . . . . . . . . . . . . RGKRIDVEKALKMAIVHDLA
Template Known Secondary structure  ..............TT



TTTT
Template Predicted Secondary structure 


..............





Template SS confidence 




















































   32.......40.........50 .........60.........70
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions