Return to main results Retrieve Phyre Job Id

Job DescriptionP15723
Confidence45.56%DateThu Jan 5 11:34:52 GMT 2012
Rank62Aligned Residues28
% Identity39%Templatec1vj7B_
PDB info PDB header:hydrolase, transferaseChain: B: PDB Molecule:bifunctional rela/spot; PDBTitle: crystal structure of the bifunctional catalytic fragment of relseq,2 the rela/spot homolog from streptococcus equisimilis.
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   67..70.........80.........90.........100.........110........
Predicted Secondary structure 














Query SS confidence 



















































Query Sequence  LTHSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTGPFESIVEMSCLMHD
Query Conservation 














  
   
                    




 



Alig confidence 















........................











Template Conservation 
 
 
 

 

     ........................
   
 





Template Sequence  IVHPIQVAGILADLHL. . . . . . . . . . . . . . . . . . . . . . . . DAVTVACGFLHD
Template Known Secondary structure  TTT
........................
STT
Template Predicted Secondary structure 


........................
Template SS confidence 



















































   51........60...... ...70........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions