Return to main results Retrieve Phyre Job Id

Job DescriptionP08957
Confidence21.13%DateThu Jan 5 11:01:44 GMT 2012
Rank338Aligned Residues35
% Identity14%Templatec2ohoA_
PDB info PDB header:isomeraseChain: A: PDB Molecule:glutamate racemase; PDBTitle: structural basis for glutamate racemase inhibitor
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   265....270.........280.........290.........300.........310.
Predicted Secondary structure 























Query SS confidence 














































Query Sequence  TNPPFGSAAGTNITRTFVHPTSNKQLCFMQHIIETLHPGGRAAVVVP
Query Conservation   




                     

   
  

 

  


 
Alig confidence 














............



















Template Conservation     


 

   
  ............     
  
   
   



Template Sequence  ARAPYGPRPKKQIKE. . . . . . . . . . . . YTWELVNFLLTQNVKMIVFA
Template Known Secondary structure  GG


TTS
............TTT
S
Template Predicted Secondary structure 








............




Template SS confidence 














































   38.40.........50.. .......60.........70..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions