Return to main results Retrieve Phyre Job Id

Job DescriptionF2X7N5
Confidence17.16%DateThu Jan 5 10:56:28 GMT 2012
Rank54Aligned Residues32
% Identity25%Templatec2ovqA_
PDB info PDB header:transcription/cell cycleChain: A: PDB Molecule:s-phase kinase-associated protein 1a; PDBTitle: structure of the skp1-fbw7-cyclinedegc complex
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   150.........160 .........170.........180.
Predicted Secondary structure 



..........






Query SS confidence 










. . . . . . . . . .




















Query Sequence  FLLGVAALGLD. . . . . . . . . . AVPIEGFDAAILDAEFGLKEK
Query Conservation 
 


 




..........
  
       
   
 

  
Alig confidence 










..........




















Template Conservation 

 

 

 
  
  
 
  

  
 


 



  


  
Template Sequence  LILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKND
Template Known Secondary structure  T
TTTTT






Template Predicted Secondary structure 









Template SS confidence 









































   1103......1110.........1120.........1130.........1140....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions