Return to main results Retrieve Phyre Job Id

Job DescriptionP39385
Confidence30.58%DateThu Jan 5 12:00:18 GMT 2012
Rank8Aligned Residues20
% Identity30%Templated1xqoa_
SCOP infoDNA-glycosylase DNA-glycosylase AgoG-like
Resolution1.03

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   53......60... ......70..
Predicted Secondary structure 

..........








Query SS confidence 










. . . . . . . . . .








Query Sequence  ADWFAVVALFR. . . . . . . . . . RVPIPIISR
Query Conservation 





 



..........  


  
 
Alig confidence 










..........








Template Conservation 







 


 
   
        



Template Sequence  TLVFTIKILNYAYMCSRGVNRVLPFDIPIP
Template Known Secondary structure  T





TTS


Template Predicted Secondary structure 













Template SS confidence 





























   141........150.........160.........170
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions