Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFD4
Confidence2.94%DateThu Jan 5 11:25:58 GMT 2012
Rank19Aligned Residues27
% Identity15%Templated1s5qb_
SCOP infoPAH2 domain PAH2 domain PAH2 domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   37..40.........50.........60.........70.
Predicted Secondary structure 










Query SS confidence 


































Query Sequence  RRLLGLFQNRYGPNRVGWGGSLQLVADMIKMFFKE
Query Conservation 


 
  
 
 

  

  




  
  


 

Alig confidence 











........














Template Conservation   


 

 
 
 ........ 
  

 

  
   
Template Sequence  NKIKNRFQGQPD. . . . . . . . IYKAFLEILHTYQKE
Template Known Secondary structure  TTT
........
Template Predicted Secondary structure 


........
Template SS confidence 


































   312.......320... ......330........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions