Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFD4
Confidence4.94%DateThu Jan 5 11:25:58 GMT 2012
Rank9Aligned Residues21
% Identity38%Templatec3pesA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein gp49; PDBTitle: crystal structure of uncharacterized protein from pseudomonas phage2 yua
Resolution1.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   33......40.........50.........60...
Predicted Secondary structure 








Query SS confidence 






























Query Sequence  SFGERRLLGLFQNRYGPNRVGWGGSLQLVAD
Query Conservation     



 
  
 
 

  

  




  
Alig confidence 













..........






Template Conservation   


 


   
 
..........
   


Template Sequence  PWLERKLTEAERER. . . . . . . . . . IDQAVFD
Template Known Secondary structure  TT

..........
Template Predicted Secondary structure  ..........
Template SS confidence 






























   57..60.........70 .......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions