Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFD4
Confidence2.32%DateThu Jan 5 11:25:58 GMT 2012
Rank32Aligned Residues22
% Identity27%Templatec1bajA_
PDB info PDB header:viral proteinChain: A: PDB Molecule:gag polyprotein; PDBTitle: hiv-1 capsid protein c-terminal fragment plus gag p2 domain
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   41........50.........60.........70
Predicted Secondary structure 









Query SS confidence 





























Query Sequence  GLFQNRYGPNRVGWGGSLQLVADMIKMFFK
Query Conservation 
  
 
 

  

  




  
  


 
Alig confidence 









........











Template Conservation 
   





........


 


 

  
Template Sequence  SILDIRQGPK. . . . . . . . EPFRDYVDRFYK
Template Known Secondary structure  GGGG



SS........

Template Predicted Secondary structure 









........

Template SS confidence 





























   149150........ .160.........170
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions