Return to main results Retrieve Phyre Job Id

Job DescriptionP45532
Confidence34.76%DateWed Jan 25 15:20:55 GMT 2012
Rank87Aligned Residues30
% Identity23%Templatec2hunB_
PDB info PDB header:lyaseChain: B: PDB Molecule:336aa long hypothetical dtdp-glucose 4,6-dehydratase; PDBTitle: crystal structure of hypothetical protein ph0414 from pyrococcus2 horikoshii ot3
Resolution2.07 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30........
Predicted Secondary structure 










Query SS confidence 





































Query Sequence  MRFAIVVTGPAYGTQQASSAFQFAQALIADGHELSSVF
Query Conservation 

  
 

  
        
   
 
 
  

 
  

Alig confidence 

..







.....
















.


Template Conservation 

..







.....


  

  

  
  
. 
 
Template Sequence  MK. . LLVTGGMG. . . . . FIGSNFIRYILEKHPDW. EVI
Template Known Secondary structure 
..TTTS.....
TT
.
Template Predicted Secondary structure 
..



.....



.
Template SS confidence 





































   4. ....10... ......20.........30 ...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions