Return to main results Retrieve Phyre Job Id

Job DescriptionP45532
Confidence42.81%DateWed Jan 25 15:20:55 GMT 2012
Rank68Aligned Residues28
% Identity21%Templatec2ggsB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:273aa long hypothetical dtdp-4-dehydrorhamnose PDBTitle: crystal structure of hypothetical dtdp-4-dehydrorhamnose2 reductase from sulfolobus tokodaii
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.....
Predicted Secondary structure 










Query SS confidence 


































Query Sequence  MRFAIVVTGPAYGTQQASSAFQFAQALIADGHELS
Query Conservation 

  
 

  
        
   
 
 
  

 
 
Alig confidence 

..







.....

















Template Conservation 

..







..... 

  

  
   
  
 
Template Sequence  MR. . TLITGASG. . . . . QLGIELSRLLSERHEVIK
Template Known Secondary structure 

..STTS.....TTTS
Template Predicted Secondary structure 
..



.....


Template SS confidence 


































   1. .......10 .........20........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions