Return to main results Retrieve Phyre Job Id

Job DescriptionP25714
Confidence4.20%DateThu Jan 5 11:42:16 GMT 2012
Rank97Aligned Residues35
% Identity6%Templatec2hyxA_
PDB info PDB header:unknown functionChain: A: PDB Molecule:protein dipz; PDBTitle: structure of the c-terminal domain of dipz from mycobacterium2 tuberculosis
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   384.....390.........400 .........410........
Predicted Secondary structure  .............



Query SS confidence 
















. . . . . . . . . . . . .

















Query Sequence  RMLQPKIQAMRERLGDD. . . . . . . . . . . . . KQRISQEMMALYKAEKVN
Query Conservation    
 
    
  


 
.............      
   



 


Alig confidence 
















.............

















Template Conservation    


 
  
   
 
 

 



       
     
        
 
Template Sequence  QRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAKGAANLGIS
Template Known Secondary structure  GGGT

SSGGGG
T

Template Predicted Secondary structure 

















Template SS confidence 















































   441........450.........460.........470.........480........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions