Return to main results Retrieve Phyre Job Id

Job DescriptionQ46797
Confidence32.01%DateThu Jan 5 12:34:17 GMT 2012
Rank11Aligned Residues29
% Identity34%Templatec2odbB_
PDB info PDB header:protein bindingChain: B: PDB Molecule:serine/threonine-protein kinase pak 6; PDBTitle: the crystal structure of human cdc42 in complex with the crib domain2 of human p21-activated kinase 6 (pak6)
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   183......190.........200.........210.........220..
Predicted Secondary structure 




















Query SS confidence 







































Query Sequence  ISNPKRLDGIPVQMNAVHIRFDSNSPVMADVQEEGKPQLW
Query Conservation 



  


 
  
  





  
  
 



 



 
Alig confidence 






......











.....









Template Conservation 

 
 

...... 
  


 
  
.....
 
 


 

Template Sequence  ISAPQNF. . . . . . QHRVHTSFDPKE. . . . . GKFVGLPPQW
Template Known Secondary structure 




S
......





TTT.....TS

Template Predicted Secondary structure 






......


.....



Template SS confidence 







































   12...... .20.........30 .........40
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions