Return to main results Retrieve Phyre Job Id

Job DescriptionP39401
Confidence12.34%DateThu Jan 5 12:00:36 GMT 2012
Rank59Aligned Residues17
% Identity53%Templatec3o2sB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:rna polymerase ii subunit a c-terminal domain phosphatase PDBTitle: crystal structure of the human symplekin-ssu72 complex
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   648.650.........660.........670.........680.
Predicted Secondary structure 




















Query SS confidence 

































Query Sequence  RPESWGRWSNAQLGDEVKIEYKHPLPKKFDLVIT
Query Conservation                                    
Alig confidence 








.................







Template Conservation 





   .................  





Template Sequence  RPERFQNCK. . . . . . . . . . . . . . . . . DLFDLILT
Template Known Secondary structure  S

BGGG

.................


S
Template Predicted Secondary structure 




.................

Template SS confidence 

































   94.....100.. .......110
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions