Return to main results Retrieve Phyre Job Id

Job DescriptionP77364
Confidence20.50%DateThu Jan 5 12:28:12 GMT 2012
Rank219Aligned Residues29
% Identity24%Templatec2gx8B_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:nif3-related protein; PDBTitle: the crystal stucture of bacillus cereus protein related to nif3
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   283......290.........300.........310.........320..
Predicted Secondary structure 
















Query SS confidence 







































Query Sequence  QGAALVITGEGRIDSQTAGGKAPLGVASVAKQFNVPVIGI
Query Conservation    








  
 


 

 
  

  
    



 
Alig confidence 














...........













Template Conservation   



 



 
 
 ...........  

   

 


 
Template Sequence  KGADVYVTGDMYYHV. . . . . . . . . . . AHDAMMLGLNIVDP
Template Known Secondary structure  TT
SS

...........T

Template Predicted Secondary structure 







...........


Template SS confidence 







































   303......310....... ..320.........330.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions