Return to main results Retrieve Phyre Job Id

Job DescriptionP77364
Confidence24.17%DateThu Jan 5 12:28:12 GMT 2012
Rank185Aligned Residues39
% Identity38%Templatec2f9iC_
PDB info PDB header:transferaseChain: C: PDB Molecule:acetyl-coenzyme a carboxylase carboxyl PDBTitle: crystal structure of the carboxyltransferase subunit of acc2 from staphylococcus aureus
Resolution1.98 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   288.290.........300.. .......310.........320.......
Predicted Secondary structure 








..........................







Query SS confidence 














. . . . . . . . . . . . . . . . . . . . . . . . . .
























Query Sequence  VITGEGRIDSQTAGG. . . . . . . . . . . . . . . . . . . . . . . . . . KAPLGVASVAKQFNVPVIGIAGVLG
Query Conservation 





  
 


 
..........................
 
  

  
    



 
 
   
Alig confidence 














..........................

.





















Template Conservation 

 
 
 
 
  
 


 
 
           
   
 
 

 . 
    
    



 



 
Template Sequence  MIGGIGFLNGRAVTVIGQQRGKDTKDNIYRNFGMAHPEGYRKA. LRLMKQAEKFNRPIFTFIDTKG
Template Known Secondary structure  TT


SSTGGG


.TT

S
Template Predicted Secondary structure 
















.






Template SS confidence 

































































   94.....100.........110.........120.........130...... ...140.........150........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions