Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACV6
Confidence4.56%DateThu Jan 5 11:19:10 GMT 2012
Rank89Aligned Residues36
% Identity14%Templatec1efpC_
PDB info PDB header:electron transportChain: C: PDB Molecule:protein (electron transfer flavoprotein); PDBTitle: electron transfer flavoprotein (etf) from paracoccus2 denitrificans
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50
Predicted Secondary structure 



























Query SS confidence 















































Query Sequence  VTRPRAERGAFPPGTEHYGRSLLGAPLIWFPAPAASRESGLILAGTHG
Query Conservation                    
 
  



    
       


 




Alig confidence 






.












...........















Template Conservation   


 

. 

 
   




...........
  
 
 



 



Template Sequence  ASRAAVD. SGYAPNDWQVGQT. . . . . . . . . . . GKVVAPELYVAVGISG
Template Known Secondary structure 
.TTSS
GGGBBSSS...........SB



SS


Template Predicted Secondary structure 
.







...........






Template SS confidence 















































   225....230. ........240.... .....250.........260
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions