Return to main results Retrieve Phyre Job Id

Job DescriptionQ46799
Confidence33.27%DateThu Jan 5 12:34:21 GMT 2012
Rank58Aligned Residues41
% Identity44%Templated2fmra_
SCOP infoEukaryotic type KH-domain (KH-domain type I) Eukaryotic type KH-domain (KH-domain type I) Eukaryotic type KH-domain (KH-domain type I)
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   43......50.........60.........70.........80.........90.........100.........110.........
Predicted Secondary structure 










































Query SS confidence 












































































Query Sequence  NDEQARSLPGVLAIFTWEDVPDIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARDELTAEKAAQLVS
Query Conservation 
 
 
 
 


  
 
  


                        

   
 
 




 


 
   
  
   
 
Alig confidence 


















....................................





















Template Conservation 


 

 



  
 

  ....................................   
 
 


 


  

  

Template Sequence  NIQQARKVPGVTAIDLDED. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . TCTFHIYGEDQDAVKKARSFLE
Template Known Secondary structure  STTTT....................................TTS

Template Predicted Secondary structure 






....................................




Template SS confidence 












































































   25....30.........40... ......50.........60.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions