Return to main results Retrieve Phyre Job Id

Job DescriptionQ46799
Confidence37.80%DateThu Jan 5 12:34:21 GMT 2012
Rank43Aligned Residues49
% Identity37%Templated2cpqa1
SCOP infoEukaryotic type KH-domain (KH-domain type I) Eukaryotic type KH-domain (KH-domain type I) Eukaryotic type KH-domain (KH-domain type I)
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   43......50.........60.........70.........80.........90.........100.........110.........120..
Predicted Secondary structure 










































Query SS confidence 















































































Query Sequence  NDEQARSLPGVLAIFTWEDVPDIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARDELTAEKAAQLVSIEW
Query Conservation 
 
 
 
 


  
 
  


                        

   
 
 




 


 
   
  
   
 
 
Alig confidence 





















....................................





















Template Conservation 


 

 



  
 


 
  ....................................
 
 


 


  

  

  
Template Sequence  NIQQARKVPGVTAIELDEDTGT. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . FRIYGESADAVKKARGFLEFVE
Template Known Secondary structure  TSTTTTTT....................................SSS


Template Predicted Secondary structure 








....................................

Template SS confidence 















































































   240.........250.........260. ........270.........280...
 
   123....
Predicted Secondary structure 



Query SS confidence 




Query Sequence  QELPV
Query Conservation 
 

 
Alig confidence 




Template Conservation 
   
Template Sequence  DFIQV
Template Known Secondary structure 




Template Predicted Secondary structure 
Template SS confidence 




   284....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions