Return to main results Retrieve Phyre Job Id

Job DescriptionQ46799
Confidence15.90%DateThu Jan 5 12:34:21 GMT 2012
Rank92Aligned Residues49
% Identity18%Templatec3e0mB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:peptide methionine sulfoxide reductase msra/msrb PDBTitle: crystal structure of fusion protein of msra and msrb
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   48.50.........60.........70.........80.........90.........100.........110.. .......120.....
Predicted Secondary structure 






































..




Query SS confidence 
































































. .












Query Sequence  RSLPGVLAIFTWEDVPDIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARDELTAE. . KAAQLVSIEWQEL
Query Conservation   
 


  
 
  


                        

   
 
 




 


 
   
 .. 
   
 
 

 
Alig confidence 









...................................




...











..










..
Template Conservation    
 

  
 ...................................




...
   



  
  






 
 

..
Template Sequence  SRISGVLETS. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . VGYAN. . . GQVETTNYQLLKETDHAETVQVIYD. .
Template Known Secondary structure  TSTT...................................S...
SSS


TTTT

..
Template Predicted Secondary structure 


...................................
...












..
Template SS confidence 















































































   1920........ .30... ......40.........50........
 
   126...130......
Predicted Secondary structure 




Query SS confidence 










Query Sequence  PVITTPEAALA
Query Conservation 
 
     
  
Alig confidence 










Template Conservation 
  


  

 
Template Sequence  EKEVSLREILL
Template Known Secondary structure  TTTS
Template Predicted Secondary structure 




Template SS confidence 










   5960.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions