Return to main results Retrieve Phyre Job Id

Job DescriptionP77562
Confidence7.43%DateThu Jan 5 12:30:35 GMT 2012
Rank72Aligned Residues24
% Identity33%Templatec1th1C_
PDB info PDB header:cell adhesion/antitumor proteinChain: C: PDB Molecule:adenomatous polyposis coli protein; PDBTitle: beta-catenin in complex with a phosphorylated apc 20aa2 repeat fragment
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   243......250.........260.........270...
Predicted Secondary structure 














Query SS confidence 






























Query Sequence  NAAFQNAVSKASGVKLALDGDLIRYDSKEPG
Query Conservation 




  
 



  
  




 
  
  
Alig confidence 





.......

















Template Conservation   



 .......





 










Template Sequence  NAAVQR. . . . . . . VQVLPDADLLHFATESTS
Template Known Secondary structure  .......












S


Template Predicted Secondary structure  .......






Template SS confidence 






























   1473..... .1480.........1490......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions