Return to main results Retrieve Phyre Job Id

Job DescriptionP77562
Confidence18.62%DateThu Jan 5 12:30:35 GMT 2012
Rank32Aligned Residues39
% Identity31%Templatec1ee8A_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:mutm (fpg) protein; PDBTitle: crystal structure of mutm (fpg) protein from thermus thermophilus hb8
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   94.....100.........110.........120.........130.........140.. .......150........
Predicted Secondary structure 














.....
Query SS confidence 
















































. . . . .















Query Sequence  AVPGLSKIAWQEIDRRAERMHIPAFLVHTALKIKSPNGKSYSERLDSVR. . . . . TEKQLSAIFDDLINMV
Query Conservation   



 

   


 


   

   
  

   

 



 






.....




  

 


   
Alig confidence 













..........................








.....















Template Conservation    







 


..........................
 


 
      

  
   
      

Template Sequence  LAAGVGNIYADEAL. . . . . . . . . . . . . . . . . . . . . . . . . . FRARLSPFRPARSLTEEEARRLYRALREVL
Template Known Secondary structure  SSTT

..........................TT

SSSBGGG

Template Predicted Secondary structure 





..........................












Template SS confidence 





































































   155....160........ .170.........180.........190........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions