Return to main results Retrieve Phyre Job Id

Job DescriptionP39370
Confidence3.04%DateThu Jan 5 12:00:04 GMT 2012
Rank83Aligned Residues27
% Identity15%Templated2z1ea1
SCOP infoBacillus chorismate mutase-like PurM N-terminal domain-like PurM N-terminal domain-like
Resolution1.55

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   193......200.........210.........220.......
Predicted Secondary structure 














Query SS confidence 


































Query Sequence  PQHFNHMVEAFRRDLKQYHSQLNNITDAPWFCGDT
Query Conservation     
  

   
 

             
   

 
Alig confidence 

















........








Template Conservation     
     

       ........
  



 
Template Sequence  MEVLKRVLKSMDETAREV. . . . . . . . PVPIVTGDT
Template Known Secondary structure  T........T

Template Predicted Secondary structure 
........

Template SS confidence 


































   107..110.........120.... .....130...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions