Return to main results Retrieve Phyre Job Id

Job DescriptionP39370
Confidence3.48%DateThu Jan 5 12:00:04 GMT 2012
Rank70Aligned Residues32
% Identity13%Templatec3a8tA_
PDB info PDB header:transferaseChain: A: PDB Molecule:adenylate isopentenyltransferase; PDBTitle: plant adenylate isopentenyltransferase in complex with atp
Resolution2.37 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   188.190.........200.........210.........220.........230
Predicted Secondary structure 















Query SS confidence 










































Query Sequence  DYASHPQHFNHMVEAFRRDLKQYHSQLNNITDAPWFCGDTTWY
Query Conservation    
 
   
  

   
 

             
   

    
Alig confidence 

















...........













Template Conservation 

  
   
   
  
  ........... 
  






  
Template Sequence  TPADFRSLAGKAVSEITG. . . . . . . . . . . RRKLPVLVGGSNSF
Template Known Secondary structure 
...........TT



Template Predicted Secondary structure 
...........





Template SS confidence 










































   101........110........ .120.........130..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions