Return to main results Retrieve Phyre Job Id

Job DescriptionP39370
Confidence2.51%DateThu Jan 5 12:00:04 GMT 2012
Rank95Aligned Residues26
% Identity23%Templatec2k19A_
PDB info PDB header:antimicrobial proteinChain: A: PDB Molecule:putative piscicolin 126 immunity protein; PDBTitle: nmr solution structure of pisi
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   196...200.........210.........220.......
Predicted Secondary structure 














Query SS confidence 































Query Sequence  FNHMVEAFRRDLKQYHSQLNNITDAPWFCGDT
Query Conservation 
  

   
 

             
   

 
Alig confidence 













......











Template Conservation 

 

  
  

  ......   


 




Template Sequence  LKKVLENYLEELKQ. . . . . . KSASVPLILSRM
Template Known Secondary structure  TS......SSS
Template Predicted Secondary structure  ......



Template SS confidence 































   37..40.........50 .........60..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions