Return to main results Retrieve Phyre Job Id

Job DescriptionP39370
Confidence8.88%DateThu Jan 5 12:00:04 GMT 2012
Rank41Aligned Residues24
% Identity8%Templatec1y80A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:predicted cobalamin binding protein; PDBTitle: structure of a corrinoid (factor iiim)-binding protein from2 moorella thermoacetica
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   194.....200.........210.........220.....
Predicted Secondary structure 













Query SS confidence 































Query Sequence  QHFNHMVEAFRRDLKQYHSQLNNITDAPWFCG
Query Conservation    
  

   
 

             
   
Alig confidence 
















........






Template Conservation        
  

      ........ 
 



Template Sequence  MNMKSTIDALIAAGLRD. . . . . . . . RVKVIVG
Template Known Secondary structure  TT
GG........G
Template Predicted Secondary structure 




........

Template SS confidence 































   154.....160.........170 .......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions