Return to main results Retrieve Phyre Job Id

Job DescriptionP75968
Confidence2.95%DateThu Jan 5 12:16:35 GMT 2012
Rank81Aligned Residues26
% Identity38%Templatec2ntxB_
PDB info PDB header:signaling proteinChain: B: PDB Molecule:embcab41934.1;
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10.........20.........30.........
Predicted Secondary structure 





Query SS confidence 

































Query Sequence  EPPKNYNEMLPKLHKATFLNTLIYCILLVIYEYI
Query Conservation 



 





 





  
 
    



 
 
Alig confidence 















........









Template Conservation   

 

 




 


........ 


 


 
Template Sequence  EIPESYIDSLPKNGRA. . . . . . . . SLGDSIYKSI
Template Known Secondary structure 




SS........
Template Predicted Secondary structure 





........
Template SS confidence 

































   205....210.........220 .........230
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions