Return to main results Retrieve Phyre Job Id

Job DescriptionP06989
Confidence17.06%DateThu Jan 5 10:59:47 GMT 2012
Rank32Aligned Residues25
% Identity28%Templatec2i7uA_
PDB info PDB header:de novo protein/ligand binding proteinChain: A: PDB Molecule:four-alpha-helix bundle; PDBTitle: structural and dynamical analysis of a four-alpha-helix2 bundle with designed anesthetic binding pockets
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   148.150.........160.........170.......
Predicted Secondary structure 


Query SS confidence 





























Query Sequence  QKVGEEGVETALAATVHDRFELTNEASDLM
Query Conservation 






 
   
    
 
 
  
 



Alig confidence 












.....











Template Conservation 












.....











Template Sequence  KKLREEAAKLFEE. . . . . WKKLAEEAAKLL
Template Known Secondary structure 
S.....
Template Predicted Secondary structure  .....
Template SS confidence 





























   2.......10.... .....20......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions