Return to main results Retrieve Phyre Job Id

Job DescriptionP33226
Confidence24.28%DateThu Jan 5 11:51:25 GMT 2012
Rank214Aligned Residues30
% Identity40%Templated1cpqa_
SCOP infoFour-helical up-and-down bundle Cytochromes Cytochrome c'-like
Resolution1.72

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   304.....310.........320....... ..330...
Predicted Secondary structure 







..................

Query SS confidence 























. . . . . . . . . . . . . . . . . .





Query Sequence  WMKKGDMVNDIKPIWAYADSLYNG. . . . . . . . . . . . . . . . . . TCNQCH
Query Conservation        
       
  
      .................. 
  

Alig confidence 























..................





Template Conservation 
     
         

  
  

  

      
   

 





Template Sequence  WANMDDFGAKGKAMHEAGGAVIAAANAGDGAAFGAALQKLGGTCKACH
Template Known Secondary structure  ST
Template Predicted Secondary structure 




Template SS confidence 















































   75....80.........90.........100.........110.........120..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions