Return to main results Retrieve Phyre Job Id

Job DescriptionP76216
Confidence7.53%DateThu Jan 5 12:20:40 GMT 2012
Rank90Aligned Residues28
% Identity32%Templated1dqna_
SCOP infoPRTase-like PRTase-like Phosphoribosyltransferases (PRTases)
Resolution1.75

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   367..370.........380.........390.........400....
Predicted Secondary structure 








Query SS confidence 





































Query Sequence  RLRVVLTEEERRAVNPAVMMNDTLFNALNDWVDRYYRD
Query Conservation 



 

  




   
 

  
 
 
  

 




Alig confidence 












..........














Template Conservation     

 
 



 .......... 
 


  


 


Template Sequence  KFHLLATFEECKA. . . . . . . . . . LAADTARRMNEYYKD
Template Known Secondary structure  G

..........TT
Template Predicted Secondary structure 
..........

Template SS confidence 





































   31........40... ......50........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions