Return to main results Retrieve Phyre Job Id

Job DescriptionP76216
Confidence53.42%DateThu Jan 5 12:20:40 GMT 2012
Rank12Aligned Residues32
% Identity19%Templatec3pdxA_
PDB info PDB header:transferaseChain: A: PDB Molecule:tyrosine aminotransferase; PDBTitle: crystal structural of mouse tyrosine aminotransferase
Resolution2.91 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   361........370.........380.........390.........400..
Predicted Secondary structure 









Query SS confidence 









































Query Sequence  GGPACLRLRVVLTEEERRAVNPAVMMNDTLFNALNDWVDRYY
Query Conservation 









 

  




   
 

  
 
 
  

 


Alig confidence 
















..........














Template Conservation       



     
 
..........   
  
        
Template Sequence  EYPNFFRVVITVPEVMM. . . . . . . . . . LEACSRIQEFCEQHY
Template Known Secondary structure  T

SS
S
..........TTT
Template Predicted Secondary structure 






..........
Template SS confidence 









































   411........420....... ..430.........440..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions