Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAV8
Confidence56.06%DateThu Jan 5 11:13:57 GMT 2012
Rank28Aligned Residues28
% Identity21%Templatec1pt1B_
PDB info PDB header:lyaseChain: B: PDB Molecule:aspartate 1-decarboxylase; PDBTitle: unprocessed pyruvoyl dependent aspartate decarboxylase with histidine2 11 mutated to alanine
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   115....120.........130.........140.........150......
Predicted Secondary structure 




















Query SS confidence 









































Query Sequence  PVTRVRIRNVNTGTFIEADVQTPNGVVEYEGSARIDGVPGTA
Query Conservation    
 


 



   
 
 
    
     

  
 





Alig confidence 
















..............










Template Conservation 
 
 
 
 




 

 ..............



 
  


Template Sequence  ENEAIDIWNVTNGKRFS. . . . . . . . . . . . . . TYAIAAERGSR
Template Known Secondary structure  TT
TTT

..............
TTS
Template Predicted Secondary structure 







..............





Template SS confidence 









































   40.........50...... ...60.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions