Return to main results Retrieve Phyre Job Id

Job DescriptionP39220
Confidence4.52%DateThu Jan 5 11:58:32 GMT 2012
Rank82Aligned Residues25
% Identity20%Templatec3zvmA_
PDB info PDB header:hydrolase/transferase/dnaChain: A: PDB Molecule:bifunctional polynucleotide phosphatase/kinase; PDBTitle: the structural basis for substrate recognition by mammalian2 polynucleotide kinase 3' phosphatase
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   106...110.........120.........130......
Predicted Secondary structure 










Query SS confidence 






























Query Sequence  DELVAKGNMRWVAQTFGDIELSVTFFIEKNK
Query Conservation      

              
 




    
Alig confidence 









......














Template Conservation         
  ......  

   
  




Template Sequence  DHLQEQANEG. . . . . . IPISVEDSVFVGDAA
Template Known Secondary structure  SSTT......



STT

S

Template Predicted Secondary structure 


......







Template SS confidence 






























   266...270..... ....280.........290
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions