Return to main results Retrieve Phyre Job Id

Job DescriptionP39220
Confidence6.71%DateThu Jan 5 11:58:32 GMT 2012
Rank46Aligned Residues28
% Identity14%Templatec3n3fB_
PDB info PDB header:protein bindingChain: B: PDB Molecule:collagen alpha-1(xv) chain; PDBTitle: crystal structure of the human collagen xv trimerization domain: a2 potent trimerizing unit common to multiplexin collagens
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   103......110.........120.........130........
Predicted Secondary structure 












Query SS confidence 



































Query Sequence  KNPDELVAKGNMRWVAQTFGDIELSVTFFIEKNKIC
Query Conservation 
 
    

              
 




    
 
Alig confidence 












......





..








Template Conservation   
 
 
       ...... 




..

 
  


Template Sequence  SNMDDMLQKAHLV. . . . . . IEGTFI. . YLRDSTEFF
Template Known Secondary structure  SST
GGGS......
TT..TTTT
Template Predicted Secondary structure 


......


..

Template SS confidence 



































   7..10......... 20..... ....30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions