Return to main results Retrieve Phyre Job Id

Job DescriptionP39220
Confidence10.90%DateThu Jan 5 11:58:32 GMT 2012
Rank24Aligned Residues25
% Identity28%Templatec3lo0A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:inorganic pyrophosphatase; PDBTitle: crystal structure of inorganic pyrophosphatase from2 ehrlichia chaffeensis
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   35....40.........50. ........
Predicted Secondary structure  .......
Query SS confidence 
















. . . . . . .







Query Sequence  IFQRLWETLRHLFWSDK. . . . . . . QTEAYKLL
Query Conservation 
















.......







Alig confidence 
















.......







Template Conservation 
       
  

  

 


      
 
 
Template Sequence  FPVSFLNSISHFFTFYVSVEGWKDVTVAEKLI
Template Known Secondary structure  S


Template Predicted Secondary structure 










Template SS confidence 































   127..130.........140.........150........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions