Return to main results Retrieve Phyre Job Id

Job DescriptionP39220
Confidence11.30%DateThu Jan 5 11:58:32 GMT 2012
Rank22Aligned Residues27
% Identity26%Templatec3ia0c_
PDB info PDB header:structural proteinChain: C: PDB Molecule:ethanolamine utilization protein euts; PDBTitle: ethanolamine utilization microcompartment shell subunit,2 euts-g39v mutant
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........
Predicted Secondary structure 

















Query SS confidence 






































Query Sequence  MKVSVPGMPVTLLNMSKNDIYKMVSGDKMDVKMNIFQRL
Query Conservation    




  

   

 


 






    






Alig confidence 















.......




.....





Template Conservation 


 











.......
 
  ..... 
  

Template Sequence  IQEFVPGKQVTLAHLI. . . . . . . AHPGE. . . . . ELAKKI
Template Known Secondary structure 







.......S


.....
Template Predicted Secondary structure 



.......


.....
Template SS confidence 






































   7..10.........20.. ..... ..30...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions