Return to main results Retrieve Phyre Job Id

Job DescriptionP39220
Confidence6.62%DateThu Jan 5 11:58:32 GMT 2012
Rank47Aligned Residues34
% Identity26%Templatec2xz2A_
PDB info PDB header:rna-binding proteinChain: A: PDB Molecule:cstf-50, isoform b; PDBTitle: crystal structure of cstf-50 homodimerization domain
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   56...60.........70.........80.........90.........100..
Predicted Secondary structure 



















Query SS confidence 














































Query Sequence  YKLLFNFVNNQTGNINASEYFTGAINENEREKFINSLELFNKLKTCA
Query Conservation 




 


        
 






 


 
 
 

  




  
Alig confidence 










...





..........
















Template Conservation 

 







...
 



..........   
  
   

   

Template Sequence  REILYRLMISQ. . . LMYDGL. . . . . . . . . . EKFAMELSMLVKADQCA
Template Known Secondary structure  ...TT
..........T




Template Predicted Secondary structure  .............


Template SS confidence 














































   15....20..... ....30. ........40........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions